Mouse Anti-ZNF557 Antibody (CBMOAB-63367FYA)


Cat: CBMOAB-63367FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63367FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63367FYA 100 µg
MO-AB-07194W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07194W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO63367FYA
SpecificityThis antibody binds to Rhesus ZNF557.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF557 Antibody is a mouse antibody against ZNF557. It can be used for ZNF557 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF557
UniProt IDF7DA47
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: LVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENFRNVASLGTGDQVDKPGLITQLEQEDEVMTEERGILPVLVRNSSGQGLRRWECYNTLGRLRTFGLSPPMYFHDFNFLSSRSLLGPQGRKKRHVSFSDIKYSVNMSSLNQQERNHLGAEFSECNQCFKVFSTKSSLMRHKKIHTGEKRYDCNECGKSYSSKSYVTVHKRIHNGEKPYKCSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCCREFRTQSIFTRHKRVHTGESHYVCNQCGKAFSTGSSLSLHYSIHTGENPYECHNCGKTFRRSSNLTQHVRTHTGEKPYKCNECGISFTSSFSLTVHRRIHNREKSYECSDCGKAFNVLSSVKKHRRTHSGKRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry