AibGenesis™ Mouse Anti-ZNF567 Antibody (CBMOAB-63378FYA)


Cat: CBMOAB-63378FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63378FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63378FYA 100 µg
MO-AB-15482W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15482W 100 µg
MO-AB-23329R Monoclonal Cattle (Bos taurus) WB, ELISA MO23329R 100 µg
MO-AB-68545W Monoclonal Marmoset WB, ELISA MO68545W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63378FYA
SpecificityThis antibody binds to Rhesus ZNF567.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF567 Antibody is a mouse antibody against ZNF567. It can be used for ZNF567 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF567
UniProt IDF6UXK4
Protein RefseqThe length of the protein is 622 amino acids long.
The sequence is show below: SQGSVSFNDVTVDFTQEEWQHLDHAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLERGEEPWTSFSGHTCLEENWKAEDFLLKFKEHQEKYSRSVVSINHKKLVKEKGNIYEKTFTLGKNPVNSKNLPPEYDTHGRILKNVSELIISNLNPARKRLSEYNGYGKSFLSTKQETTHPEVKSHNQSDRAFSHNEVLMQYQKTETPAQSFGYNDCEKSFLKRGGLMTHNRPYRGENPSVYNKKRRVTNIEKKHTCNECGKSFCRKSVLILHQGIHSEEKPYQCHQCGNAFRRKSYLIDHQRTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECLQCRNAFRLKSHLIRHQRTHTGEKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKPYICNECGKSFSQKTTLALHEKTHNEEKPYICSECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICNECGKSFRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCSECGKCFRQKTNLIVHQRTHTGGADGLTGCLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry