AibGenesis™ Mouse Anti-ZNF569 Antibody (CBMOAB-63382FYA)


Cat: CBMOAB-63382FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63382FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO63382FYA 100 µg
MO-AB-23331R Monoclonal Cattle (Bos taurus) WB, ELISA MO23331R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO63382FYA
SpecificityThis antibody binds to Rhesus ZNF569.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF569 Antibody is a mouse antibody against ZNF569. It can be used for ZNF569 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 569; ZNF569
UniProt IDH9EYH1
Protein RefseqThe length of the protein is 299 amino acids long.
The sequence is show below: MTESQGTVTFKDVAIDFTQEEWKRLDPAQRNLYRNVMLENYNNLITVGYPFTKPDVIFKLEQEEEPWVMEEEVLRRHWKGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNAKCLIRKEHCEYNEPVKSYANSSSHFVITPFKCNHCGKGFNQTLDLIRHLRIHSGEKPYECSNCKKAFSHKEKLIKHYKIHSREQSYKCNECGKAFIKMSNLIRHQRIHTGEKPHKCNECGKAFSECSGLTTHLVIHTGEKPYK.
For Research Use Only | Not For Clinical Use.
Online Inquiry