AibGenesis™ Mouse Anti-ZNF572 Antibody (CBMOAB-63392FYA)


Cat: CBMOAB-63392FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63392FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO63392FYA 100 µg
MO-AB-09533H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09533C 100 µg
MO-AB-23333R Monoclonal Cattle (Bos taurus) WB, ELISA MO23333R 100 µg
MO-AB-68547W Monoclonal Marmoset WB, ELISA MO68547W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO63392FYA
SpecificityThis antibody binds to Rhesus ZNF572.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF572 Antibody is a mouse antibody against ZNF572. It can be used for ZNF572 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 572; ZNF572
UniProt IDH9FIN5
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: QCGECGKSFSNTSHLIIHERTHTGEKPYKCPECGKRFSSSSHLIQHHRSHTGEKPYECSVCGKGFSHSYVLIEHQRTHTGEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPYKCLECGKSFGCNSTLIKHQRIHTGEKPYQCPECGKNFSRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry