Mouse Anti-ZNF662 Antibody (MO-AB-07231W)


Cat: MO-AB-07231W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07231W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO07231W 100 µg
MO-AB-19743W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19743W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO07231W
SpecificityThis antibody binds to Rhesus ZNF662.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF662 Antibody is a mouse antibody against ZNF662. It can be used for ZNF662 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 662 isoform 2; ZNF662
UniProt IDH9FHC6
Protein RefseqThe length of the protein is 86 amino acids long.
The sequence is show below: TGEKPYECKDCGKGFMWNSDLSQHQRVHTGDKPHECTDCGKSFFCKAHLIRHQRIHTGERPYTCNDCGKAFSQNSVLIKHQRRHAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry