Mouse Anti-ZNF677 Antibody (CBMOAB-63510FYA)


Cat: CBMOAB-63510FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63510FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63510FYA 100 µg
MO-AB-07238W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07238W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO63510FYA
SpecificityThis antibody binds to Rhesus ZNF677.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF677 Antibody is a mouse antibody against ZNF677. It can be used for ZNF677 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 677; ZNF677
UniProt IDH9FHR5
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: LLHTQYGRTHIREKSYKCNDCGKAFSKSSNLTDHQRIHSGQRPYQCKECGKAFNQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLASHQRMHTGEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry