AibGenesis™ Mouse Anti-ZSWIM1 Antibody (MO-AB-07290W)


Cat: MO-AB-07290W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07290W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) WB, ELISA MO07290W 100 µg
MO-AB-09568H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09568C 100 µg
MO-AB-10576Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10576Y 100 µg
MO-AB-19749W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19749W 100 µg
MO-AB-23412R Monoclonal Cattle (Bos taurus) WB, ELISA MO23412R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus)
CloneMO07290W
SpecificityThis antibody binds to Rhesus ZSWIM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZSWIM1 Antibody is a mouse antibody against ZSWIM1. It can be used for ZSWIM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger SWIM domain-containing protein 1; ZSWIM1
UniProt IDG7N4N6
Protein RefseqThe length of the protein is 456 amino acids long.
The sequence is show below: MALTMLNGLLIKDSSPPMLLHQVNKTAQLDTFNYQSCFMQSIFDHFPEILFIHRTYNPRGKVLYTFLVDGPRVQLEGHLARAVYFAIPAKEDTEGLAQMFQVFKKFNPAWERVCTILVDPHFLPLPTLAMEFPAAEVLLSAFHICKFLQAKFYQLSLERPMERLLLTSLQSTMCSATAGNLRKLYTLLSNCIPPAKLPELHSHWLLNDRIWLAHRWRSRAESSRYFQSLEVTTRILSQFFGTTPSEKQGMASLFRYMQQNSADMANFNQGLCAQNNHAPSDTIPESPKVEQLVESHIQHSLNAICTGPAAQLCLGELAVVQKSTHLIGSGSEKMNIQILEDTHKVQPQPPASCSCYFNQAFHLPCRHILAMLSARRQVLQPDMLPAQWTAGCATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQHCSKEEFERRYSTLRELADSWIGPYEQVQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry