Mouse Anti-Rice Act Antibody (CBMOAB-18477FYB)


Cat: CBMOAB-18477FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18477FYB
SpecificityThis antibody binds to Rice Act.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActin is a highly conserved protein and an essential component of cell cytoskeleton and plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. Preferentially expressed in young and expanding tissues, floral organ primordia, developing seeds and emerging inflorescence.
Product OverviewMouse Anti-Rice Act Antibody is a mouse antibody against Act. It can be used for Act detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin; Actin-7, putative, expressed; Os11g0163100 protein; cDNA clone:001-035-C05, full insert sequence; Act; Os11g0163100; LOC_Os11g06390
UniProt IDQ67G20
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELEAAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPAIVHRKCF.
See other products for " ACT "
MO-DKB-0022RARabbit Anti-ACT Antibody (MO-DKB-0022RA)
CBMOAB-1575FYCMouse Anti-Arabidopsis ACT Antibody (CBMOAB-1575FYC)
MO-AB-34105HMouse Anti-Tomato ACT Antibody (MO-AB-34105H)
MO-AB-07270RMouse Anti-Cattle ACT Antibody (MO-AB-07270R)
MO-AB-70628WMouse Anti-A. thaliana ACT Antibody (MO-AB-70628W)
For Research Use Only | Not For Clinical Use.
Online Inquiry