Mouse Anti-Rice ADIPOR2 Antibody (CBMOAB-18522FYB)


Cat: CBMOAB-18522FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18522FYB
SpecificityThis antibody binds to Rice ADIPOR2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).
Product OverviewMouse Anti-Rice ADIPOR2 (clone MO18522FYB) Antibody (CBMOAB-18522FYB) is a mouse antibody against ADIPOR2. It can be used for ADIPOR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeptahelical transmembrane protein ADIPOR2; PAQR family protein ADIPOR2; ADIPOR2; Os02g0179500 LOC_Os02g08320
UniProt IDQ6ETK9
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MQGAASHDAAAAAAAAAVLGGGHGVPRWPRMVFLVGAMTCLAISATAHLLACHSRRASVVFWQLDYAGISAMIVASFVPPVYYAFLCHRPARVAYLSAISALGALVVGALLSPPCSSPRFRRLRAALFLAMGLSGVVPALHALWLNWGHAACYLALSLEVAMGLAYAAGAWFYVSRVPEKWRPGVFDVVGHSHQIFHVLVLVGAVTHYVAVDVLLNWRETVAAACSATS.

Reference

See other products for " ADIPOR2 "

MO-AB-20759WMouse Anti-Chimpanzee ADIPOR2 Antibody (MO-AB-20759W)
CBMOAB-65039FYAMouse Anti-Zebrafish adipor2 Antibody (CBMOAB-65039FYA)
MO-AB-01260HMouse Anti-Frog adipor2 Antibody (MO-AB-01260H)
CBMOAB-65038FYAMouse Anti-Zebrafish adipor2 Antibody (CBMOAB-65038FYA)
MO-AB-23573RMouse Anti-Pig ADIPOR2 Antibody (MO-AB-23573R)
MO-AB-07094YMouse Anti-Rabbit AdipoR2 Antibody (MO-AB-07094Y)
MO-AB-20760WMouse Anti-Chimpanzee ADIPOR2 Antibody (MO-AB-20760W)
MO-AB-50501WMouse Anti-Marmoset ADIPOR2 Antibody (MO-AB-50501W)
MO-AB-23571RMouse Anti-Pig adipoR2 Antibody (MO-AB-23571R)
MO-AB-36674WMouse Anti-Goat ADIPOR2 Antibody (MO-AB-36674W)
For Research Use Only | Not For Clinical Use.

Online Inquiry