Mouse Anti-ADIPOR2 Antibody (CBMOAB-18522FYB)
Cat: CBMOAB-18522FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-18522FYB | Monoclonal | Rice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO18522FYB | 100 µg | ||
CBMOAB-35228FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35228FYA | 100 µg | ||
CBMOAB-65037FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65037FYA | 100 µg | ||
MO-AB-00058Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00058Y | 100 µg | ||
MO-AB-01259H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01259C | 100 µg | ||
MO-AB-07056R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07056R | 100 µg | ||
MO-AB-07094Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07094Y | 100 µg | ||
MO-AB-20760W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20760W | 100 µg | ||
MO-AB-22814H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO22814C | 100 µg | ||
MO-AB-23573R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23573R | 100 µg | ||
MO-AB-36674W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36674W | 100 µg | ||
MO-AB-50501W | Monoclonal | Marmoset | WB, ELISA | MO50501W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO18522FYB |
Specificity | This antibody binds to Rice ADIPOR2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]). |
Product Overview | Mouse Anti-Rice ADIPOR2 Antibody is a mouse antibody against ADIPOR2. It can be used for ADIPOR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Heptahelical transmembrane protein ADIPOR2; PAQR family protein ADIPOR2; ADIPOR2; Os02g0179500 LOC_Os02g08320 |
UniProt ID | Q6ETK9 |
Protein Refseq | The length of the protein is 229 amino acids long. The sequence is show below: MQGAASHDAAAAAAAAAVLGGGHGVPRWPRMVFLVGAMTCLAISATAHLLACHSRRASVVFWQLDYAGISAMIVASFVPPVYYAFLCHRPARVAYLSAISALGALVVGALLSPPCSSPRFRRLRAALFLAMGLSGVVPALHALWLNWGHAACYLALSLEVAMGLAYAAGAWFYVSRVPEKWRPGVFDVVGHSHQIFHVLVLVGAVTHYVAVDVLLNWRETVAAACSATS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry