Mouse Anti-ADIPOR2 Antibody (CBMOAB-18522FYB)


Cat: CBMOAB-18522FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18522FYB Monoclonal Rice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO18522FYB 100 µg
CBMOAB-35228FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35228FYA 100 µg
CBMOAB-65037FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65037FYA 100 µg
MO-AB-00058Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00058Y 100 µg
MO-AB-01259H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01259C 100 µg
MO-AB-07056R Monoclonal Cattle (Bos taurus) WB, ELISA MO07056R 100 µg
MO-AB-07094Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07094Y 100 µg
MO-AB-20760W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20760W 100 µg
MO-AB-22814H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO22814C 100 µg
MO-AB-23573R Monoclonal Pig (Sus scrofa) WB, ELISA MO23573R 100 µg
MO-AB-36674W Monoclonal Goat (Capra hircus) WB, ELISA MO36674W 100 µg
MO-AB-50501W Monoclonal Marmoset WB, ELISA MO50501W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO18522FYB
SpecificityThis antibody binds to Rice ADIPOR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).
Product OverviewMouse Anti-Rice ADIPOR2 Antibody is a mouse antibody against ADIPOR2. It can be used for ADIPOR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeptahelical transmembrane protein ADIPOR2; PAQR family protein ADIPOR2; ADIPOR2; Os02g0179500 LOC_Os02g08320
UniProt IDQ6ETK9
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MQGAASHDAAAAAAAAAVLGGGHGVPRWPRMVFLVGAMTCLAISATAHLLACHSRRASVVFWQLDYAGISAMIVASFVPPVYYAFLCHRPARVAYLSAISALGALVVGALLSPPCSSPRFRRLRAALFLAMGLSGVVPALHALWLNWGHAACYLALSLEVAMGLAYAAGAWFYVSRVPEKWRPGVFDVVGHSHQIFHVLVLVGAVTHYVAVDVLLNWRETVAAACSATS.
For Research Use Only | Not For Clinical Use.
Online Inquiry