AibGenesis™ Mouse Anti-CDSP32 Antibody (CBMOAB-22109FYB)


Cat: CBMOAB-22109FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22109FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO22109FYB 100 µg
CBMOAB-25947FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO25947FC 100 µg
MO-DKB-02960W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO22109FYB
SpecificityThis antibody binds to Rice CDSP32.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThiol-disulfide oxidoreductase that may participate in various redox reactions. May act as electron donor to the BAS1 peroxiredoxin. Possesses low insulin disulfide bonds reducing activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice CDSP32 Antibody is a mouse antibody against CDSP32. It can be used for CDSP32 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThioredoxin-like protein CDSP32, chloroplastic; Chloroplastic drought-induced stress protein of 32 KDa; OsCDSP32; CDSP32; Os07g0476900 LOC_Os07g29410
UniProt IDQ84NN4
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MASTAAFLSTLAGSTSLGGATPASGGGSGRSKTARFLRRRRRGGAVRAAVSGTEQAPETTKKKGGGGGGGDERVVQVHSAEELDGALRAAKERLVVVEFAASHSVNSSRIYPCMVELSRTCGDVDFLLVMGDESDATRELCRREGITAVPHFTFYKGAEKVHEEEGIGPDQLAGDVLYYGDHHSAVVQLHSRADVESLISDHRGEGGKLVVLDVGLKRCGPCVKVYPTVVKLSRTMADTTVFARMNGDENDSCMEFLRDMDVVEVPTFLFIRDGDIVGRYVGSGRGELIGEILRYNGVKVT.
For Research Use Only | Not For Clinical Use.
Online Inquiry