Mouse Anti-SL1 Antibody (CBMOAB-89422FYB)


Cat: CBMOAB-89422FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89422FYB Monoclonal Rice (Oryza), Cattle (Bos taurus) WB, ELISA MO89422FYB 100 µg
Inquiry
MO-AB-20175R Monoclonal Cattle (Bos taurus) WB, ELISA MO20175R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Cattle (Bos taurus)
CloneMO89422FYB
SpecificityThis antibody binds to Rice SL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates floral organ identity and cell proliferation in the inner floral whorls. Probably specifies the identities of lodicule and stamen through positive regulation of MADS16 expression. May contribute to morphogenesis by suppressing OSH1 expression in the lateral organs. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice SL1 Antibody is a mouse antibody against SL1. It can be used for SL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein STAMENLESS 1; OsJAG; Zinc finger protein OPEN BEAK; SL1; OBP; Os01g0129000 LOC_Os01g03840
UniProt IDQ9LG97
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MNSSRRQEGSPLDLNNLPDEFGKQTVESSTTTAASSAEASRVTKKKSNGGKDEAGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNRARQLVFGNDSLAAVGAQLNFRDVNMGGGGAAAPPPTMQMGGGGFRGGGVGGDPCIPLRPVQPRLSPPQPPPYHHYLYTTTAPPSALHPMSYPATYPAPPRHQQPAAVGDYVIGHAVSAGDALVAPPPPPHRASFSCFGAPLAAPPANVQPDNGNCNCSFGCGHSNRNVNAAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry