Mouse Anti-SRY Antibody (MO-AB-10095Y)
Cat: MO-AB-10095Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-10095Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO10095Y | 100 µg | ||
CBMOAB-59114FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59114FYA | 100 µg | ||
MO-AB-08734W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08734W | 100 µg | ||
MO-AB-33531W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33531W | 100 µg | ||
MO-AB-34303W | Monoclonal | Donkey (Equus asinus) | WB, ELISA | MO34303W | 100 µg | ||
MO-AB-38231W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38231W | 100 µg | ||
MO-AB-46693W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46693W | 100 µg | ||
MO-AB-65380W | Monoclonal | Marmoset | WB, ELISA | MO65380W | 100 µg | ||
MO-AB-20925R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20925R | 100 µg | ||
MO-AB-30453R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30453R | 100 µg | ||
MO-AB-29214H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29214C | 100 µg | ||
MO-AB-01448L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01448L | 100 µg | ||
MO-AB-17793Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17793Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO10095Y |
Specificity | This antibody binds to Rabbit SRY. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. |
Product Overview | This product is a mouse antibody against SRY. It can be used for SRY detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sex-determining region Y protein; SRY |
UniProt ID | Q49KM0 |
Protein Refseq | The length of the protein is 207 amino acids long. The sequence is show below: MYALMFGALYSDAYTPAKQQSNSFALVSTNHQCNTGGTRKVSGQERVKRPMNAFMVWSQHQRRQVALQNPKMRNSDISKQLGHQWKMLSEAEKWPFFQEAQRLQAMHKEKYPDYKYRPRRKVKILQKSDSLLLAQPTSTLCSEVHMDEGLYTCTGMKEQLICSQPVNTGSSLPQQQCHSNWTSWQENRVTLAAQTCENIPLYHKLQP. |
See other products for " SRY "
MO-AB-22356W | Mouse Anti-SRY Antibody (MO-AB-22356W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry