Mouse Anti-SRY Antibody (MO-AB-10095Y)


Cat: MO-AB-10095Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10095Y Monoclonal Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO10095Y 100 µg
CBMOAB-59114FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59114FYA 100 µg
MO-AB-08734W Monoclonal Cat (Felis catus) WB, ELISA MO08734W 100 µg
MO-AB-33531W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33531W 100 µg
MO-AB-34303W Monoclonal Donkey (Equus asinus) WB, ELISA MO34303W 100 µg
MO-AB-38231W Monoclonal Goat (Capra hircus) WB, ELISA MO38231W 100 µg
MO-AB-46693W Monoclonal Horse (Equus caballus) WB, ELISA MO46693W 100 µg
MO-AB-65380W Monoclonal Marmoset WB, ELISA MO65380W 100 µg
MO-AB-20925R Monoclonal Cattle (Bos taurus) WB, ELISA MO20925R 100 µg
MO-AB-30453R Monoclonal Pig (Sus scrofa) WB, ELISA MO30453R 100 µg
MO-AB-29214H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29214C 100 µg
MO-AB-01448L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01448L 100 µg
MO-AB-17793Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17793Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO10095Y
SpecificityThis antibody binds to Rabbit SRY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Product OverviewThis product is a mouse antibody against SRY. It can be used for SRY detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesSex-determining region Y protein; SRY
UniProt IDQ49KM0
Protein RefseqThe length of the protein is 207 amino acids long. The sequence is show below: MYALMFGALYSDAYTPAKQQSNSFALVSTNHQCNTGGTRKVSGQERVKRPMNAFMVWSQHQRRQVALQNPKMRNSDISKQLGHQWKMLSEAEKWPFFQEAQRLQAMHKEKYPDYKYRPRRKVKILQKSDSLLLAQPTSTLCSEVHMDEGLYTCTGMKEQLICSQPVNTGSSLPQQQCHSNWTSWQENRVTLAAQTCENIPLYHKLQP.
See other products for " SRY "
For Research Use Only | Not For Clinical Use.
Online Inquiry