AibGenesis™ Mouse Anti-PsbO Antibody (MO-AB-35078H)


Cat: MO-AB-35078H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-35078H Monoclonal WB, ELISA MO35078C 100 µg
MOFAB-219W Arabidopsis, Rice WB 100 µg
MO-DKB-01771W Polyclonal A. thaliana (Arabidopsis thaliana), Synechocystis sp. PCC 6803 WB 100 µg
MO-DKB-01953W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-DKB-0427RA Polyclonal WB 100 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum), A. thaliana (Arabidopsis thaliana), Synechocystis sp. PCC 6803, A. thaliana (Arabidopsis thaliana); C. sativus (Cucumis sativus); H. vulgare (Hordeum vulgare); N. tabacum (Nicotiana tabacum); P. sativum (Pisum sativum); T. aestivum (Triticum aestivum); Maize (Zea mays), Arabidopsis, Rice
CloneMO35078C
SpecificityThis antibody binds to Tomato PsbO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PsbO. It can be used for PsbO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names33kDa protein of oxygen-evolving complex; PsbO
UniProt IDQ157M6
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: QLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry