Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast ECM1 Antibody (CBMOAB-00021CR)


Cat: CBMOAB-00021CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00021CR
SpecificityThis antibody binds to Yeast ECM1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPre-ribosomal factor involved in 60S ribosomal protein subunit export from the nucleus.
Product OverviewMouse Anti-Yeast ECM1 (clone MO00021CR) Antibody (CBMOAB-00021CR) is a mouse antibody against ECM1. It can be used for ECM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesShuttling pre-60S factor ECM1; Extracellular mutant protein 1; Protein SIM1; ECM1; SIM1; YAL059W
UniProt IDP39715
Protein RefseqThe length of the protein is 212 amino acids long. The sequence is show below: MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDEEIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEE.
For Research Use Only | Not For Clinical Use.

Online Inquiry