Mouse Anti-ECM1 Antibody (MO-AB-11806R)


Cat: MO-AB-11806R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11806R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO11806R 100 µg
CBMOAB-41439FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41439FYA 100 µg
MO-AB-18491W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18491W 100 µg
MO-AB-54673W Monoclonal Marmoset WB, ELISA MO54673W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO11806R
SpecificityThis antibody binds to Cattle ECM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene.
Product OverviewMouse Anti-Cattle ECM1 Antibody is a mouse antibody against ECM1. It can be used for ECM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesECM1 protein; ECM1
UniProt IDA5PJT7
Protein RefseqThe length of the protein is 517 amino acids long.
The sequence is show below: MGTMSGAALVLACLTVASVASDGGFKASGQRELGPQPLTHPLQQVGYAAPPSPPLSRALPQGHPRTSQHSLHSEGQSEVQPSPSQDAIPLQEELPPPQVPIEQKEEKPAPSMDHSPPEPESWNPAQHCQHGRPRGGWGHRLDGFPPGRPSLDNLDQICLPSRQHVVYGPWNLPQTGFSHLSRQGETLNLLETGYSRCCRCRNRTNRLDCAELVWEDSVTRFCEAEFSVKTQPHGCCKKQGEARLSCFQEEAPRPH.
See other products for " ECM1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry