Mouse Anti-LSM3 Antibody (CBMOAB-02107CR)
Cat: CBMOAB-02107CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02107CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sea-anemone, Silkworm (Bombyx mori) | WB, ELISA | MO02107CR | 100 µg | ||
| CBMOAB-06190HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06190HB | 100 µg | ||
| CBMOAB-23325FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO23325FYA | 100 µg | ||
| MO-AB-04183W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04183W | 100 µg | ||
| MO-AB-04929H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04929C | 100 µg | ||
| MO-AB-11348W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11348W | 100 µg | ||
| MO-AB-11988Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11988Y | 100 µg | ||
| MO-AB-13901Y | Monoclonal | Sea-anemone | WB, ELISA | MO13901Y | 100 µg | ||
| MO-AB-15122R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15122R | 100 µg | ||
| MO-AB-23382H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23382C | 100 µg | ||
| MO-AB-26857H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26857C | 100 µg | ||
| MO-AB-27789W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27789W | 100 µg | ||
| MO-AB-35068W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35068W | 100 µg | ||
| MO-AB-43241W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43241W | 100 µg | ||
| MO-AB-48624W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO48624W | 100 µg | ||
| MO-AB-58434W | Monoclonal | Marmoset | WB, ELISA | MO58434W | 100 µg | ||
| MO-AB-70037W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70037W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sea-anemone, Silkworm (Bombyx mori) |
| Clone | MO02107CR |
| Specificity | This antibody binds to Yeast LSM3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Yeast LSM3 Antibody is a mouse antibody against LSM3. It can be used for LSM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | U6 snRNA-associated Sm-like protein LSm3; SmX4 protein; LSM3; SMX4 USS2; YLR438C-A |
| UniProt ID | P57743 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSEDDDGAVEI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry