AibGenesis™ Mouse Anti-MHF2 Antibody (CBMOAB-02276CR)
Cat: CBMOAB-02276CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Silkworm (Bombyx mori) |
| Clone | MO02276CR |
| Specificity | This antibody binds to Yeast MHF2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | DNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:20347428). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork. Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast MHF2 Antibody is a mouse antibody against MHF2. It can be used for MHF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MHF histone-fold complex subunit 2; MPH1-associated histone-fold protein 2; MHF2; YDL160C-A |
| UniProt ID | Q3E829 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry