AibGenesis™ Mouse Anti-MHF2 Antibody (CBMOAB-02276CR)


Cat: CBMOAB-02276CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02276CR Monoclonal Yeast, Silkworm (Bombyx mori) WB, ELISA MO02276CR 100 µg
MO-AB-70048W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70048W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, Silkworm (Bombyx mori)
CloneMO02276CR
SpecificityThis antibody binds to Yeast MHF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:20347428). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork. Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast MHF2 Antibody is a mouse antibody against MHF2. It can be used for MHF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHF histone-fold complex subunit 2; MPH1-associated histone-fold protein 2; MHF2; YDL160C-A
UniProt IDQ3E829
Protein RefseqThe length of the protein is 80 amino acids long. The sequence is show below: MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM.
For Research Use Only | Not For Clinical Use.
Online Inquiry