AibGenesis™ Mouse Anti-aagab Antibody (CBMOAB-64278FYA)


Cat: CBMOAB-64278FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64278FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO64278FYA 100 µg
MO-AB-10683W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10683W 100 µg
MO-AB-50158W Monoclonal Marmoset WB, ELISA MO50158W 100 µg
MO-AB-06730R Monoclonal Cattle (Bos taurus) WB, ELISA MO06730R 100 µg
MO-AB-01115H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01115C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO64278FYA
SpecificityThis antibody binds to Zebrafish aagab.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the gamma-adaptin and alpha-adaptin subunits of complexes involved in clathrin-coated vesicle trafficking. Mutations in this gene are associated with type I punctate palmoplantar keratoderma. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish aagab Antibody is a mouse antibody against aagab. It can be used for aagab detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92663; aagab; zgc:9266
UniProt IDQ6DH35
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MADDQGDEAPTLPCILVTSCDSNFKEEELIRQILSSESPPQPNRIEERVSWYPWTINNKYYTANVSLCVVSSTFDMNAEVARSMQAFIIYFDSKTKDSLNNVNSWLSVVEELAPEVLILVCDHVCDSDEGVSRQDAQQWCLAHAFELVELNPQDLPDEDDDFPESTGVKRTIQALNANVWSSVEMKDEHSQGFGLMSSLVASRHNNPRPSQETLSSHSPSNSTDEGTESQRAENNQSNTVDTAVDPMIDIDIQELANLTAGDPDVENFERLFTKLKEMKDKASSLPHEQRKVHAEKVAKAFWMAIGGDQDEIDGLSSGEES.
For Research Use Only | Not For Clinical Use.
Online Inquiry