Mouse Anti-Zebrafish aagab Antibody (CBMOAB-64278FYA)


Cat: CBMOAB-64278FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64278FYA
SpecificityThis antibody binds to Zebrafish aagab.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the gamma-adaptin and alpha-adaptin subunits of complexes involved in clathrin-coated vesicle trafficking. Mutations in this gene are associated with type I punctate palmoplantar keratoderma. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish aagab (clone MO64278FYA) Antibody (CBMOAB-64278FYA) is a mouse antibody against aagab. It can be used for aagab detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92663; aagab; zgc:9266
UniProt IDQ6DH35
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MADDQGDEAPTLPCILVTSCDSNFKEEELIRQILSSESPPQPNRIEERVSWYPWTINNKYYTANVSLCVVSSTFDMNAEVARSMQAFIIYFDSKTKDSLNNVNSWLSVVEELAPEVLILVCDHVCDSDEGVSRQDAQQWCLAHAFELVELNPQDLPDEDDDFPESTGVKRTIQALNANVWSSVEMKDEHSQGFGLMSSLVASRHNNPRPSQETLSSHSPSNSTDEGTESQRAENNQSNTVDTAVDPMIDIDIQELANLTAGDPDVENFERLFTKLKEMKDKASSLPHEQRKVHAEKVAKAFWMAIGGDQDEIDGLSSGEES.
For Research Use Only | Not For Clinical Use.

Online Inquiry