AibGenesis™ Mouse Anti-aida Antibody (CBMOAB-65307FYA)


Cat: CBMOAB-65307FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65307FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO65307FYA 100 µg
MO-AB-23605W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23605W 100 µg
MO-AB-50619W Monoclonal Marmoset WB, ELISA MO50619W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO65307FYA
SpecificityThis antibody binds to Zebrafish aida.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish aida Antibody is a mouse antibody against aida. It can be used for aida detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAxin interactor, dorsalization-associated protein; Axin interaction partner and dorsalization antagonist; aid
UniProt IDQ6PBN2
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MSDVNKTVQKWHASFKKGTDFDSWGQLVEAIDEYQILARQLQKEVQSSNSHDFTEEQKKTLGKFATCLEMRSAALQCTQSQEEFKLEDLKKLEPIIKNILTYNKDFPFDVQPVPLRKILAPGEEENLDVEEDLDAGTGAGSTPSFTSRLPGSLLPRLPSEPGMTLLTLTIEKIGLKDAGQCIDPYITVSVKDLNGIDLNPVQDTPVATRKEDTYIHFSVDVEIQRHLEKLPKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLNLLTKKPLYLHLNQTLHKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry