AibGenesis™ Mouse Anti-alox5ap Antibody (CBMOAB-65580FYA)


Cat: CBMOAB-65580FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65580FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO65580FYA 100 µg
MO-AB-07172Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07172Y 100 µg
MO-AB-07269R Monoclonal Cattle (Bos taurus) WB, ELISA MO07269R 100 µg
MO-AB-14166Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14166Y 100 µg
MO-AB-23689R Monoclonal Pig (Sus scrofa) WB, ELISA MO23689R 100 µg
MO-AB-24042H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24042C 100 µg
MO-AB-43643W Monoclonal Horse (Equus caballus) WB, ELISA MO43643W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO65580FYA
SpecificityThis antibody binds to Zebrafish alox5ap.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish alox5ap Antibody is a mouse antibody against alox5ap. It can be used for alox5ap detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:63982; Zgc:63982 protein; alox5ap; zgc:6398
UniProt IDQ7T3B7
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MYASVMDNIFLLVLVTLLSVVQNVFFALKVEKECTGHQSKRSAAFERLSCAKRNCMDTYPTFLAVLWCAGICLSQAPAAFAGILYLVVRQKYFVGYLGETSQSTPGFLFGKRILFFLSLMCVVGIINHLMLTYGGSDYKEYIQTITKAASTLLLLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry