AibGenesis™ Mouse Anti-apoc2 Antibody (CBMOAB-66167FYA)
Cat: CBMOAB-66167FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-66167FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus) | WB, ELISA | MO66167FYA | 100 µg | ||
| MO-AB-07495R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07495R | 100 µg | ||
| MO-AB-24118H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24118C | 100 µg | ||
| MO-AB-28995W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28995W | 100 µg | ||
| MO-AB-32847H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32847C | 100 µg | ||
| MO-AB-41252W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41252W | 100 µg | ||
| MO-AB-51105W | Monoclonal | Marmoset | WB, ELISA | MO51105W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus) |
| Clone | MO66167FYA |
| Specificity | This antibody binds to Zebrafish apoc2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish apoc2 Antibody is a mouse antibody against apoc2. It can be used for apoc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | apoc2; Apolipoprotein C2 |
| UniProt ID | E9QEQ1 |
| Protein Refseq | The length of the protein is 100 amino acids long. The sequence is show below: MNKILAITVFVAFLALGAESFRVPRQAEDEKGTIAVVVDTLKSYYDQSVDTASGYVETIKGYKLEEKAKTIYSDTVRAVGTYAGIFQDQLYHILYSQDSH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry