Mouse Anti-Zebrafish apoc2 Antibody (CBMOAB-66167FYA)


Cat: CBMOAB-66167FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66167FYA
SpecificityThis antibody binds to Zebrafish apoc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
Product OverviewMouse Anti-Zebrafish apoc2 Antibody is a mouse antibody against apoc2. It can be used for apoc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesapoc2; Apolipoprotein C2
UniProt IDE9QEQ1
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: MNKILAITVFVAFLALGAESFRVPRQAEDEKGTIAVVVDTLKSYYDQSVDTASGYVETIKGYKLEEKAKTIYSDTVRAVGTYAGIFQDQLYHILYSQDSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry