AibGenesis™ Mouse Anti-arl9 Antibody (CBMOAB-66548FYA)


Cat: CBMOAB-66548FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66548FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO66548FYA 100 µg
MO-AB-01593H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01593C 100 µg
MO-AB-24175H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24175C 100 µg
MO-AB-51296W Monoclonal Marmoset WB, ELISA MO51296W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO66548FYA
SpecificityThis antibody binds to Zebrafish arl9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish arl9 Antibody is a mouse antibody against arl9. It can be used for arl9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153259; arl9; zgc:15325
UniProt IDQ0P495
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MPGARETGLVGAALAFTGGVACALCYLTQKTTQQEPKKKPKEEPKEKPEHEHKASKTETARKTPLITEPRTAGTQVLVLGLDGAGKTSLLHCFATGSLEQDVSPTQGFNAVSINKEDLQIEFLEIGGSEKLREYWRMYLSKARVLVFVVDSSDPERFPLAKHHLQQLLSADPGLPLVLLANKQDVSGARGITDLYEALDLGNVGDGHQLSVIGTQVKKGKCEINAGVQDARDLIIEMMANH.
For Research Use Only | Not For Clinical Use.
Online Inquiry