Mouse Anti-atp5d Antibody (CBMOAB-67092FYA)


Cat: CBMOAB-67092FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67092FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO67092FYA 100 µg
MO-AB-20029W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20029W 100 µg
MO-AB-51554W Monoclonal Marmoset WB, ELISA MO51554W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO67092FYA
SpecificityThis antibody binds to Zebrafish atp5d.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish atp5d Antibody is a mouse antibody against atp5d. It can be used for atp5d detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; atp5
UniProt IDQ6P1J5
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MFAARFLLRRAAPALRHARSYADAPSAQMSFTFASPTEVFFKEASVKQIDVPTLTGAFGILPAHVPTLQVLRPGVVTVFNDDGSSKKYFVSSGSVTVNADSSVQLLAEEAFPLESLDVAAAKANLEKAQSELVSASDEATRAEVLISIEANEAIVKALE.
For Research Use Only | Not For Clinical Use.
Online Inquiry