AibGenesis™ Mouse Anti-atp5h Antibody (CBMOAB-67101FYA)


Cat: CBMOAB-67101FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67101FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, O. mykiss (Oncorhynchus mykiss) WB, ELISA MO67101FYA 100 µg
MO-AB-07799R Monoclonal Cattle (Bos taurus) WB, ELISA MO07799R 100 µg
MO-AB-10689Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10689Y 100 µg
MO-AB-51565W Monoclonal Marmoset WB, ELISA MO51565W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, O. mykiss (Oncorhynchus mykiss)
CloneMO67101FYA
SpecificityThis antibody binds to Zebrafish atp5h.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMitochondrial membrane ATP synthase (FF ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F - containing the extramembraneous catalytic core, and F - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish atp5h Antibody is a mouse antibody against atp5h. It can be used for atp5h detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; atp5h; NP_956996.
UniProt IDQ6PC77
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MAGRRAAVKAIDWLAFAERVPPNQRAMFNSLKTRSDAISAKLASLPEKPSTINWSHYRAVVAKAGMVDEFEKKFAGLTVPEPVDTQTAKIDAQEQEANKSAAAYLEASKARIAEYEKELEKFRNMIPFDQMTIEDLNNTFPETKLDKQKYPYWPYKPVADL.
For Research Use Only | Not For Clinical Use.
Online Inquiry