Mouse Anti-atxn7l3 Antibody (CBMOAB-67228FYA)
Cat: CBMOAB-67228FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-67228FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO67228FYA | 100 µg | ||
MO-AB-00132R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00132R | 100 µg | ||
MO-AB-00145L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00145L | 100 µg | ||
MO-AB-01229W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01229W | 100 µg | ||
MO-AB-07318Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07318Y | 100 µg | ||
MO-AB-07894R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07894R | 100 µg | ||
MO-AB-08628W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08628W | 100 µg | ||
MO-AB-10705Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10705Y | 100 µg | ||
MO-AB-14325Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14325Y | 100 µg | ||
MO-AB-19294W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19294W | 100 µg | ||
MO-AB-24037R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24037R | 100 µg | ||
MO-AB-29190W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29190W | 100 µg | ||
MO-AB-32873H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32873C | 100 µg | ||
MO-AB-34445W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34445W | 100 µg | ||
MO-AB-38452W | Monoclonal | Gorilla | WB, ELISA | MO38452W | 100 µg | ||
MO-AB-41304W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41304W | 100 µg | ||
MO-AB-42953W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO42953W | 100 µg | ||
MO-AB-43826W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43826W | 100 µg | ||
MO-AB-51642W | Monoclonal | Marmoset | WB, ELISA | MO51642W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO67228FYA |
Specificity | This antibody binds to Zebrafish atxn7l3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B (PubMed:18206972, PubMed:21746879). The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Within the complex, it is required to recruit USP22 and ENY2 into the SAGA complex (PubMed:18206972). Regulates H2B monoubiquitination (H2Bub1) levels. Affects subcellular distribution of ENY2, USP22 and ATXN7L3B (PubMed:27601583). (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-Zebrafish atxn7l3 Antibody is a mouse antibody against atxn7l3. It can be used for atxn7l3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ataxin-7-like protein 3; SAGA-associated factor 11 homolog; atxn7l |
UniProt ID | F1QMW7 |
Protein Refseq | The length of the protein is 367 amino acids long. The sequence is show below: MKMEDMSLSGLDNTKLEALAHDVYSDLVEDACLGLCFEVHRAVKQGYFFLDETDQESMKDFEIVDQPGVDIFGQVYNQWKNKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIASSNNTSKSESDQEDNDDINDNDWSYGSEKKAKKRKSEKNPNSPRRSKSLKHKNGELSGGVNPDMYKYNYSSGISYETLGPEELRSILTTQCGVVSEHTKKMCTRSQRCPQHTDEQRRAVRVFLLGPSASTLPDADTMLENEAYEPPDGQLIMSRLHWDASSDISPSDSASSKASTNNSESKRPKKKKPSTLSLTPAGERDKAQERDRIAGSGSSGSSSQNALGLSSRKKRPKLAVPPAPSIYDDLN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry