Mouse Anti-Zebrafish bag1 Antibody (CBMOAB-67378FYA)


Cat: CBMOAB-67378FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO67378FYA
SpecificityThis antibody binds to Zebrafish bag1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. Multiple protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) initiation codon, and three alternative downstream AUG initiation codons. A related pseudogene has been defined on chromosome X.
Product OverviewMouse Anti-Zebrafish bag1 (clone MO67378FYA) Antibody (CBMOAB-67378FYA) is a mouse antibody against bag1. It can be used for bag1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:dkey-216e9.4 protein; bag1; si:dkey-216e9.
UniProt IDA5PLC6
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MAENALTVTVAYGTTKHSITLTGQDGHEPLLKDLCEALTEATGVPAPSQKIIFKGKSLKEMEEPLSGFGIKQGCKMMMIGKRNSPEEEVELKKLKDIEKSVEQTAKKLEKVDGELTGLKNGFLAKELQAEALNKLDQRVKVAAEQFMKILEEIDGMSLPESFSDCRMKKKGLVKTVQGYLAQCDKVEAGISDHLAKIQTKNLALAE.
For Research Use Only | Not For Clinical Use.

Online Inquiry