Mouse Anti-bag1 Antibody (CBMOAB-67378FYA)


Cat: CBMOAB-67378FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67378FYA Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO67378FYA 100 µg
CBMOAB-36741FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36741FYA 100 µg
CBMOAB-00826HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00826HB 100 µg
MO-AB-07950R Monoclonal Cattle (Bos taurus) WB, ELISA MO07950R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO67378FYA
SpecificityThis antibody binds to Zebrafish bag1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. Multiple protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) initiation codon, and three alternative downstream AUG initiation codons. A related pseudogene has been defined on chromosome X.
Product OverviewMouse Anti-Zebrafish bag1 Antibody is a mouse antibody against bag1. It can be used for bag1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:dkey-216e9.4 protein; bag1; si:dkey-216e9.
UniProt IDA5PLC6
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MAENALTVTVAYGTTKHSITLTGQDGHEPLLKDLCEALTEATGVPAPSQKIIFKGKSLKEMEEPLSGFGIKQGCKMMMIGKRNSPEEEVELKKLKDIEKSVEQTAKKLEKVDGELTGLKNGFLAKELQAEALNKLDQRVKVAAEQFMKILEEIDGMSLPESFSDCRMKKKGLVKTVQGYLAQCDKVEAGISDHLAKIQTKNLALAE.
See other products for " BAG1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry