Mouse Anti-Zebrafish baxa Antibody (CBMOAB-67454FYA)


Cat: CBMOAB-67454FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO67454FYA
SpecificityThis antibody binds to Zebrafish baxa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein encoded by the BAX gene in humans. BAX is a member of the Bcl-2 gene family. BCL2 family members form heterodimers or homodimers and act as anti- or pro-apoptotic regulators involved in a variety of cellular activities. This protein forms a heterodimer with BCL2 and functions as an apoptosis activator.
Product OverviewMouse Anti-Zebrafish baxa Antibody is a mouse antibody against baxa. It can be used for baxa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbaxa
UniProt IDI3ITC2
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNEELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCILTWIREQGGWGAIRSYFGTPTWQTVGVFLAGVLTVGLVLYKM.
See other products for " baxa "
MOFAB-006WRabbit Anti-baxa Antibody (MOFAB-006W)
MO-AB-10726YMouse Anti-O. mykiss BAXA Antibody (MO-AB-10726Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry