Mouse Anti-baxa Antibody (CBMOAB-67454FYA)


Cat: CBMOAB-67454FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67454FYA Monoclonal Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Zebrafish WB, ELISA MO67454FYA 100 µg
MO-AB-10726Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10726Y 100 µg
MOFAB-006W Polyclonal Zebrafish ELISA, WB, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Zebrafish
CloneMO67454FYA
SpecificityThis antibody binds to Zebrafish baxa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein encoded by the BAX gene in humans. BAX is a member of the Bcl-2 gene family. BCL2 family members form heterodimers or homodimers and act as anti- or pro-apoptotic regulators involved in a variety of cellular activities. This protein forms a heterodimer with BCL2 and functions as an apoptosis activator. (From NCBI)
Product OverviewMouse Anti-Zebrafish baxa Antibody is a mouse antibody against baxa. It can be used for baxa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbaxa
UniProt IDI3ITC2
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNEELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCILTWIREQGGWGAIRSYFGTPTWQTVGVFLAGVLTVGLVLYKM.
For Research Use Only | Not For Clinical Use.
Online Inquiry