Mouse Anti-c1galt1c1 Antibody (CBMOAB-68248FYA)


Cat: CBMOAB-68248FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-68248FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO68248FYA 100 µg
MO-AB-01964H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01964C 100 µg
MO-AB-09256R Monoclonal Cattle (Bos taurus) WB, ELISA MO09256R 100 µg
MO-AB-20270W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20270W 100 µg
MO-AB-52009W Monoclonal Marmoset WB, ELISA MO52009W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO68248FYA
SpecificityThis antibody binds to Zebrafish c1galt1c1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish c1galt1c1 Antibody is a mouse antibody against c1galt1c1. It can be used for c1galt1c1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesc1galt1c1
UniProt IDE7FBK8
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MMSEGSSFMKGMIFGGIFCLIMSFFETFNPGTHSEGHNHLHHHLKPVSKDELQKLSESQMSEFAMQVRVYCLIMVTPKLLVHWATANDTWSKHCDKSVFYTSEASKALDAVDLQEQDEWTRLRKAIQHAYENAGDLHWFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHTEKSGELDYVEYDSGIVLSYEAMRRLMEVFKDEDKCPERGRALWKMSEEKQLATCLKYSGVFAENGEDAQGKGLFNKKSVSSLISDSISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPYGHDFHDSLTFLPPKDSDND.
For Research Use Only | Not For Clinical Use.
Online Inquiry