Mouse Anti-ccbe1 Antibody (CBMOAB-69265FYA)


Cat: CBMOAB-69265FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69265FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO69265FYA 100 µg
MO-AB-24540H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24540C 100 µg
MO-AB-26241W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26241W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO69265FYA
SpecificityThis antibody binds to Zebrafish ccbe1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ccbe1 Antibody is a mouse antibody against ccbe1. It can be used for ccbe1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCollagen and calcium-binding EGF domain-containing protein 1; Full of fluid protein; ccbe1; fo
UniProt IDA8WGB1
Protein RefseqThe length of the protein is 401 amino acids long.
The sequence is show below: MIYPGRGASLSVAVALVLFSSGAPWTFREEKEDVDREVCSESKIATTKYPCVKSTGEVTTCYRKKCCEGFKFVLGQCIPEDYDVCAGAPCEQQCTDHFGRVVCTCYDGYRYDRERHRNREKPYCLDIDECANNNETVCSQMCVNTPGSYRCDCHSGFYLEDDGKTCTKGERAPLFEKSDNVMKEGTCSATCEDFHQMKMTVLQLKQKMSLLSSNTEINKQMTNEKMMMTTNSFLPGPPGPPGPAGTPGAKGSSGSPGQMGPPGLPGPRGDMGPIGPSPDLSHIKQGRRGPVGPPGAPGRDGMKGERGFPGPSGPPGPPGSFDFLLLMMADIRNDIAELQSKVFSRPLHSSFEDFPSAPDSWRDTPENLDFGSGEDYKSQSPPKSSRKRKLPRNLKNPDWPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry