AibGenesis™ Mouse Anti-ccdc85b Antibody (CBMOAB-69447FYA)


Cat: CBMOAB-69447FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69447FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO69447FYA 100 µg
MO-AB-15563W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15563W 100 µg
MO-AB-52430W Monoclonal Marmoset WB, ELISA MO52430W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO69447FYA
SpecificityThis antibody binds to Zebrafish ccdc85b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccdc85b Antibody is a mouse antibody against ccdc85b. It can be used for ccdc85b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesccdc85b; Coiled-Coil Domain Containing 85B
UniProt IDA2CEM9
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MGSDSEILNRELSKLSDEDLLACTKEELVNRLRKEESDKMSALIQRGRLIKEVNKQLQGHLLEIRELKVINQRLQEENQELRDLCCFLDDDRLKVKKLAREWQLFGHHAAKVMREDLGGYLKKLADLERMQDGLVKENLDLKELCLVLEEECVSRSDSSPGGSTDLNIPCMVARDVGDGSSSTGSVGSPDQLHLVCSPDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry