AibGenesis™ Mouse Anti-ccng2 Antibody (CBMOAB-69576FYA)


Cat: CBMOAB-69576FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69576FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset WB, ELISA MO69576FYA 100 µg
MO-AB-02174H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02174C 100 µg
MO-AB-19035W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19035W 100 µg
MO-AB-34505W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34505W 100 µg
MO-AB-43937W Monoclonal Horse (Equus caballus) WB, ELISA MO43937W 100 µg
MO-AB-52477W Monoclonal Marmoset WB, ELISA MO52477W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset
CloneMO69576FYA
SpecificityThis antibody binds to Zebrafish ccng2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccng2 Antibody is a mouse antibody against ccng2. It can be used for ccng2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin G2; ccng
UniProt IDQ6NZ31
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: MEAFKLMKELKSNLDLEVQYLPKETGLRLIESTQENSNGVSAKCRDARVEDLWSLTNFFGYSTQTFVLAVNLLDRFLAMMKVQPKYLACISIGCLHIAVRVTEGECNVSSSHELIRISQCKFTVSDLSRMEKIISEKLNFQFKAVTALTFLHLYHAIALSHTSNRKDVLNLDKLEAQLKACLCRIVFSKAKPSVLALSLLMLEIEALQSADLLEIAHRIQTHLKISKADLGRWRGLVGQCIRDYSSPECAKPDHKKLVWIVSRRTAQNLHSSYCSIPELPTIPEGVWDESESEDSSEDLSSGEESLSSSLGSDAEGPYFPSNFLSRARRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry