AibGenesis™ Mouse Anti-cfap299 Antibody (CBMOAB-60922FYC)


Cat: CBMOAB-60922FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60922FYC Monoclonal Zebrafish (Danio rerio), Marmoset WB, ELISA MO60922FYC 100 µg
MO-AB-52868W Monoclonal Marmoset WB, ELISA MO52868W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset
CloneMO60922FYC
SpecificityThis antibody binds to Zebrafish cfap299.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cfap299 Antibody is a mouse antibody against cfap299. It can be used for cfap299 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein C4orf22 homolog; cfap299
UniProt IDA2AVJ0
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MDNGKGVFSGEKMDEFRTYEDFLDSQIKPVDLFYLEDQELARQLVELGLKDSSLEREEFETRKAAAEASRLASGSQQKKLASTGKELKDNFLRALAEREEANRSGEMNSIIFIRDQNARGQEISAYIDYSHRLKSEDFEPYFSGKKRLLPKTSDLSFYNWRTQKSKHNNSSNYEVITENPSGLLFKCKNDRKILNVDPEKLPGDSSTRTPVQSDLYVHVVIYDHVIRKPTTRSCTPLSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry