Mouse Anti-cln8 Antibody (CBMOAB-70786FYA)


Cat: CBMOAB-70786FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70786FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset WB, ELISA MO70786FYA 100 µg
MO-AB-02478H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02478C 100 µg
MO-AB-10354R Monoclonal Cattle (Bos taurus) WB, ELISA MO10354R 100 µg
MO-AB-20994W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20994W 100 µg
MO-AB-29598W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29598W 100 µg
MO-AB-53177W Monoclonal Marmoset WB, ELISA MO53177W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset
CloneMO70786FYA
SpecificityThis antibody binds to Zebrafish cln8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment. Mutations in this gene are associated with a disorder characterized by progressive epilepsy with cognitive disabilities (EPMR), which is a subtype of neuronal ceroid lipofuscinoses (NCL). Patients with mutations in this gene have altered levels of sphingolipid and phospholipids in the brain. (From NCBI)
Product OverviewMouse Anti-Zebrafish cln8 Antibody is a mouse antibody against cln8. It can be used for cln8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescln8; CLN8, Transmembrane ER And ERGIC Protein
UniProt IDF8W2V0
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MTSQPDNLILSSGQDFSMDYTSWDIQLKITGLGFIFYTFIFFLCHVLSTLLFQTYRSLSAKEKVFWDLAATRAVFGIQGIVAGLRALMEESVLFSDKILGQEDWSWFNILTSTGFFLFENMALHMSNVVFRSFDLPLAVHHFFALAGFAGAVVWNWQGHFLPMVTLLLEMSTPFTCISWMLLKAGWSKTVFWKANQWMMIHMFHCRMVVSYYMWWVCLNHWEEMNTHIPLPQRLLFFTGLFLLTFFLNPIWTHKKTLQLLNPVDWNFHNQSPPENGPLQEQTQQKPHAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry