AibGenesis™ Mouse Anti-cxcl12a Antibody (CBMOAB-72475FYA)


Cat: CBMOAB-72475FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-72475FYA Monoclonal Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO72475FYA 100 µg
MO-AB-11123Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11123Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss)
CloneMO72475FYA
SpecificityThis antibody binds to Zebrafish cxcl12a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cxcl12a Antibody is a mouse antibody against cxcl12a. It can be used for cxcl12a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine ligand 12; Cxcl12a protein; Sdf1a; cxcl12
UniProt IDQ8AV10
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MDLKVIVVVALMAVAIHAPISNAKPISLVERCWCRSTVNTVPQRSIRELKFLHTPNCPFQVIAKLKNNKEVCINPETKWLQQYLKNAINKMKKAQQQQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry