Mouse Anti-Zebrafish dazl Antibody (CBMOAB-72955FYA)


Cat: CBMOAB-72955FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO72955FYA
SpecificityThis antibody binds to Zebrafish dazl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish dazl Antibody is a mouse antibody against dazl. It can be used for dazl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDeleted in azoospermia-like; DAZ-like protein; zDazl; dazl; zdaz
UniProt IDQ9YGW7
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MVQGVQLPVCLICGLYSQDIQKHRQGFPSSLKLSNGYILPEGKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKGYGFVYFSEDVDIQTIVDQPISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQWVNPTPYMYCSCCPPGLAPPSPVFSGGNQYMQPYSYSSPPGIMVPQVPMNYAQTTYAYQYPLPQWCGEQRTRLVNQNFVDCGVQTLLTLM.
For Research Use Only | Not For Clinical Use.
Online Inquiry