AibGenesis™ Mouse Anti-dazl Antibody (CBMOAB-72955FYA)


Cat: CBMOAB-72955FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-72955FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO72955FYA 100 µg
MO-AB-00379R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00379R 100 µg
MO-AB-01550Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01550Y 100 µg
MO-AB-02867H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02867C 100 µg
MO-AB-11186R Monoclonal Cattle (Bos taurus) WB, ELISA MO11186R 100 µg
MO-AB-11203Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11203Y 100 µg
MO-AB-14917Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14917Y 100 µg
MO-AB-25300R Monoclonal Pig (Sus scrofa) WB, ELISA MO25300R 100 µg
MO-AB-33016H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33016C 100 µg
MO-AB-37107W Monoclonal Goat (Capra hircus) WB, ELISA MO37107W 100 µg
MO-AB-53925W Monoclonal Marmoset WB, ELISA MO53925W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO72955FYA
SpecificityThis antibody binds to Zebrafish dazl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish dazl Antibody is a mouse antibody against dazl. It can be used for dazl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDeleted in azoospermia-like; DAZ-like protein; zDazl; dazl; zdaz
UniProt IDQ9YGW7
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MVQGVQLPVCLICGLYSQDIQKHRQGFPSSLKLSNGYILPEGKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKGYGFVYFSEDVDIQTIVDQPISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQWVNPTPYMYCSCCPPGLAPPSPVFSGGNQYMQPYSYSSPPGIMVPQVPMNYAQTTYAYQYPLPQWCGEQRTRLVNQNFVDCGVQTLLTLM.
For Research Use Only | Not For Clinical Use.
Online Inquiry