Mouse Anti-dazl Antibody (CBMOAB-72955FYA)
Cat: CBMOAB-72955FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-72955FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO72955FYA | 100 µg | ||
MO-AB-00379R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00379R | 100 µg | ||
MO-AB-01550Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01550Y | 100 µg | ||
MO-AB-02867H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02867C | 100 µg | ||
MO-AB-11186R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11186R | 100 µg | ||
MO-AB-11203Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11203Y | 100 µg | ||
MO-AB-14917Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14917Y | 100 µg | ||
MO-AB-25300R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25300R | 100 µg | ||
MO-AB-33016H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33016C | 100 µg | ||
MO-AB-37107W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37107W | 100 µg | ||
MO-AB-53925W | Monoclonal | Marmoset | WB, ELISA | MO53925W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) |
Clone | MO72955FYA |
Specificity | This antibody binds to Zebrafish dazl. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Zebrafish dazl Antibody is a mouse antibody against dazl. It can be used for dazl detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Deleted in azoospermia-like; DAZ-like protein; zDazl; dazl; zdaz |
UniProt ID | Q9YGW7 |
Protein Refseq | The length of the protein is 229 amino acids long. The sequence is show below: MVQGVQLPVCLICGLYSQDIQKHRQGFPSSLKLSNGYILPEGKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKGYGFVYFSEDVDIQTIVDQPISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQWVNPTPYMYCSCCPPGLAPPSPVFSGGNQYMQPYSYSSPPGIMVPQVPMNYAQTTYAYQYPLPQWCGEQRTRLVNQNFVDCGVQTLLTLM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry