Mouse Anti-DCK2 Antibody (CBMOAB-73028FYA)


Cat: CBMOAB-73028FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73028FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus) WB, ELISA MO73028FYA 100 µg
MO-AB-01555Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01555Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus)
CloneMO73028FYA
SpecificityThis antibody binds to Zebrafish DCK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPhosphorylates the deoxyribonucleosides deoxyadenosine, deoxycytidine and deoxyguanosine (PubMed:27906638). Shows highest activity against deoxyguanosine followed by deoxycytidine and then deoxyadenosine (PubMed:27906638). Shows only very minor activity against deoxyuridine and deoxythymidine (PubMed:27906638). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish DCK2 Antibody is a mouse antibody against DCK2. It can be used for DCK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDeoxycytidine kinase 2; EC 2.7.1.74; Zgc:110540; Zgc:110540 protein; DCK
UniProt IDQ5QKM9
Protein RefseqThe length of the protein is 264 amino acids long.
The sequence is show below: MATPPKRLCSSFDADLSFEKRAMKVSIEGNIAAGKSTFVRLLERASEEWEVIPEPIGKWCNVQTTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRSQLQPPSAKLQQAEKPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLRADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNQTTKLDFEYLKDLPILILDVNEDFKNDRIKQEGVIDKVKEFLNSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry