Mouse Anti-dlk2 Antibody (CBMOAB-73676FYA)


Cat: CBMOAB-73676FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-73676FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO73676FYA 100 µg
MO-AB-11483R Monoclonal Cattle (Bos taurus) WB, ELISA MO11483R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO73676FYA
SpecificityThis antibody binds to Zebrafish dlk2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish dlk2 Antibody is a mouse antibody against dlk2. It can be used for dlk2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesdlk2; Delta Like Non-Canonical Notch Ligand 2
UniProt IDF1RE96
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MKLAVVLLLCGCCVLFKHNCEAQVLFSSEETSPTPSASNCTCEIGHGKCAENGDCRCDPGWGGPMCDDCVRMPGCVHGTCHQPWQCSCMDGWAGRFCDKDVYVCSRQQPCHNGATCELSDSGDYSCLCPEGFHGRDCELKAGPCQKTKSPCKNGGLCEDLGGYAPELSCRCLAGFTGARCETNMDDCLMRPCANGATCLDGVNRFSCLCPAGFTGRFCTINLDDCASQPCLNGGRCIDRVSNFQCVCPLGFTGRTCELVSPTKSPLKAEHNPNMTLKPSHWTTPSGGEERLLKITFRTPAGGEGLSEFQLIVLLVLGGMTLAVVGLTAALVLRGYFQDRSASCQCRPAHRTQRKHSQQECKISFLQSPEKKRLNTDVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry