AibGenesis™ Mouse Anti-dph7 Antibody (CBMOAB-74045FYA)


Cat: CBMOAB-74045FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-74045FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes) WB, ELISA MO74045FYA 100 µg
MO-AB-20536W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20536W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes)
CloneMO74045FYA
SpecificityThis antibody binds to Zebrafish dph7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish dph7 Antibody is a mouse antibody against dph7. It can be used for dph7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:162277 protein; dph7; wdr85 zgc:16227
UniProt IDA3KNN6
Protein RefseqThe length of the protein is 443 amino acids long.
The sequence is show below: MGWQSRTRTLQVFDTELTADTVEWCPIPQWAHVLACGTYQQLLEGDDKQRTEGSAAPSRIGRLYLFDCNPQSSFIPPLTESQRIDTAAILDLKWCHVPISERPLLGMATASGEIQLYKLIEAQQGSSGLECELSTDLGPDRLALSLDWSTGRGESSDVRVVSSDSTGSLTLLSLGEADLTAVCQWKAHEYEAWISAFSYWDTQTVYSGGDDSKLKGWDLRMGCSSPTFTSKRHTMGVCSIHSNPHREHILATGSYDENVLLWDGRNMKQPLSETAVGGGVWRLKWHPSQEHLLLAACMHNDFQILYCQKALEGQETPCPVLGSYILHNSLAYGADWSRLPVSSSAPPSPQEPPQTSSGLVESTGHLRIQYESPTASFDTSLEDDSGRYIPDQCPSPEKSSVSDLFTSDARDSVSCLIATCSFYDHMMHVWRWDWSPEEKHESL.
For Research Use Only | Not For Clinical Use.
Online Inquiry