AibGenesis™ Mouse Anti-efnb2a Antibody (CBMOAB-74560FYA)


Cat: CBMOAB-74560FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-74560FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74560FYA 100 µg
Inquiry
MO-DKB-03336W Polyclonal Zebrafish (Danio rerio) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO74560FYA
SpecificityThis antibody binds to Zebrafish efnb2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Together with ephb4 may play a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish efnb2a Antibody is a mouse antibody against efnb2a. It can be used for efnb2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEphrin-B2a; efnb2a; efnb
UniProt IDO73874
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MGDSLWRYYFGVLVIACKVNLSRALILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVALFACIASASVIVIIIIIMLVFLLLKYRRRHRKHSPQHATTLSLSTLATPKRGGSGGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry