Mouse Anti-Zebrafish eif3g Antibody (CBMOAB-63944FYA)


Cat: CBMOAB-63944FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63944FYA
SpecificityThis antibody binds to Zebrafish eif3g.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a core subunit of the eukaryotic translation initiation factor 3 (eIF3) complex, which is required for initiation of protein translation. An N-terminal caspase cleavage product of the encoded protein may stimulate degradation of DNA. A mutation in this gene is associated with narcolepsy.
Product OverviewMouse Anti-Zebrafish eif3g Antibody is a mouse antibody against eif3g. It can be used for eif3g detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 3 subunit G; eif3g
UniProt IDQ6DRC4
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: MPSIEFDDSKPSWADQVEEEGDEGSLPSPKETVKGNIKTVTEYKIDDDGQKFKIIRTFKIETRKASKAVARRKNWKKFGNSEYDAPGPNVATTTVSDDVFMTFISSKEDLNAQDQDEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKAAEPEPAQPVQNKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSNN.
See other products for " EIF3G "
MO-AB-11298YMouse Anti-O. mykiss EIF3G Antibody (MO-AB-11298Y)
MO-AB-43113WMouse Anti-Hamsters EIF3G Antibody (MO-AB-43113W)
MO-AB-33062HMouse Anti-Nile tilapia eif3g Antibody (MO-AB-33062H)
MO-AB-38535WMouse Anti-Gorilla EIF3G Antibody (MO-AB-38535W)
MO-AB-21947WMouse Anti-Chimpanzee EIF3G Antibody (MO-AB-21947W)
MO-AB-44545WMouse Anti-Horse EIF3G Antibody (MO-AB-44545W)
MO-AB-54811WMouse Anti-Marmoset EIF3G Antibody (MO-AB-54811W)
MO-AB-25551RMouse Anti-Pig EIF3G Antibody (MO-AB-25551R)
MO-AB-00417LMouse Anti-Elephant EIF3G Antibody (MO-AB-00417L)
CBMOAB-41610FYAMouse Anti-Rhesus EIF3G Antibody (CBMOAB-41610FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry