Mouse Anti-eif3g Antibody (CBMOAB-63944FYA)
Cat: CBMOAB-63944FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-63944FYA | Monoclonal | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Primat, Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries) | WB, ELISA | MO63944FYA | 100 µg | ||
| CBMOAB-61856FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO61856FYC | 100 µg | ||
| MO-AB-08901W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08901W | 100 µg | ||
| MO-AB-21947W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21947W | 100 µg | ||
| MO-AB-34711W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34711W | 100 µg | ||
| MO-AB-38535W | Monoclonal | Gorilla | WB, ELISA | MO38535W | 100 µg | ||
| MO-AB-41602W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41602W | 100 µg | ||
| MO-AB-43113W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43113W | 100 µg | ||
| MO-AB-44545W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44545W | 100 µg | ||
| MO-AB-54811W | Monoclonal | Marmoset | WB, ELISA | MO54811W | 100 µg | ||
| MO-AB-11926R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11926R | 100 µg | ||
| MO-AB-25551R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25551R | 100 µg | ||
| MO-AB-33062H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33062C | 100 µg | ||
| MO-AB-00417L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00417L | 100 µg | ||
| MO-AB-11298Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11298Y | 100 µg | ||
| MO-AB-15149Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15149Y | 100 µg | ||
| MO-DKB-00876W | Polyclonal | Human (Homo sapiens), Primat, Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Primat, Horse (Equus caballus), Cat (Felis catus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Primat, Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries) |
| Clone | MO63944FYA |
| Specificity | This antibody binds to Zebrafish eif3g. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a core subunit of the eukaryotic translation initiation factor 3 (eIF3) complex, which is required for initiation of protein translation. An N-terminal caspase cleavage product of the encoded protein may stimulate degradation of DNA. A mutation in this gene is associated with narcolepsy. |
| Product Overview | Mouse Anti-Zebrafish eif3g Antibody is a mouse antibody against eif3g. It can be used for eif3g detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Eukaryotic translation initiation factor 3 subunit G; eif3g |
| UniProt ID | Q6DRC4 |
| Protein Refseq | The length of the protein is 293 amino acids long. The sequence is show below: MPSIEFDDSKPSWADQVEEEGDEGSLPSPKETVKGNIKTVTEYKIDDDGQKFKIIRTFKIETRKASKAVARRKNWKKFGNSEYDAPGPNVATTTVSDDVFMTFISSKEDLNAQDQDEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKAAEPEPAQPVQNKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSNN. |
See other products for " EIF3G "
| CBMOAB-41610FYA | Mouse Anti-EIF3G Antibody (CBMOAB-41610FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry