AibGenesis™ Mouse Anti-fam204a Antibody (CBMOAB-75887FYA)


Cat: CBMOAB-75887FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75887FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO75887FYA 100 µg
MO-AB-03467H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03467C 100 µg
MO-AB-12311R Monoclonal Cattle (Bos taurus) WB, ELISA MO12311R 100 µg
MO-AB-25749H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25749C 100 µg
MO-AB-26618W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26618W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO75887FYA
SpecificityThis antibody binds to Zebrafish fam204a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM204A (Family With Sequence Similarity 204 Member A) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish fam204a Antibody is a mouse antibody against fam204a. It can be used for fam204a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92799; fam204a; zgc:9279
UniProt IDQ6DGR7
Protein RefseqThe length of the protein is 234 amino acids long.
The sequence is show below: MYSGLLPSGLTEADLSSDDADEGETAEKTDEHQSHQSGTELHSASAKVECNNRKSDVHDDALEEDCLPGVSLDMWKKFKDLQRAKHDQSLRPPQIKRQRKRRHKKGGTENCSSEQKREPEEKRKEHWKELTQYFGISDRFKPPSCSKPPLMSGLEKSIESAIAEGDYGKAEELSDSLATRELAVKIAQAADCRDFSRTKQEAEASRAAQKRRKQIAWGFEAKKRWETKSNMGFM.
For Research Use Only | Not For Clinical Use.
Online Inquiry