AibGenesis™ Mouse Anti-fam210a Antibody (CBMOAB-75908FYA)


Cat: CBMOAB-75908FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75908FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO75908FYA 100 µg
MO-AB-12314R Monoclonal Cattle (Bos taurus) WB, ELISA MO12314R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO75908FYA
SpecificityThis antibody binds to Zebrafish fam210a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fam210a Antibody is a mouse antibody against fam210a. It can be used for fam210a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesfam210a; zgc:113036; Family With Sequence Similarity 210 Member A
UniProt IDF1R384
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MQRLWAPVTLRRVLLLRSVYLPHTWAMQEPPLAVLSPRYFSCTNAIRAKEAHKTSTEEQEEVPLNPPQSLAGTEGLYKADSEPVPHNKGDIDPLQDKSIGIFQRFKKTFKQYGKVMVPVHIVTSTVWFGSFYYAAMKGVNLVPFLEFIGLPDWIVGILRDSQGGYALTAYAMYKLATPARYTVTMGGTSLSVQYLRKHGYLSTPPPVKEFLQDKMEETRELLTEKMEETKERFSEKMEETKELLSERMEETKERFSETKDKFSEKLQETKDKMSFRKKAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry