Mouse Anti-fancf Antibody (CBMOAB-76072FYA)


Cat: CBMOAB-76072FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76072FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO76072FYA 100 µg
MO-AB-03488H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03488C 100 µg
MO-AB-12359R Monoclonal Cattle (Bos taurus) WB, ELISA MO12359R 100 µg
MO-AB-16818W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16818W 100 µg
MO-AB-55244W Monoclonal Marmoset WB, ELISA MO55244W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO76072FYA
SpecificityThis antibody binds to Zebrafish fancf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F. (From NCBI)
Product OverviewMouse Anti-Zebrafish fancf Antibody is a mouse antibody against fancf. It can be used for fancf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFanconi anemia F; fanc
UniProt IDQ1X870
Protein RefseqThe length of the protein is 333 amino acids long.
The sequence is show below: MEAVLRHLNNILELLAVSRTDRVREWDRPTTQRAFKWAEYCEQLHSRYQSNPTVRSRPESGLTDTNRRLRETFPSFSPVEFSELAQCQHKLIVYLLRNPSSPHFIIEMLFPDQNSPSQELLAPQNSLVTRKSAFSLLCCTVNRTSSYYGLQTEPEVRGKLLGKLLNSILARPGNEEHAKCLLDSVRCDSAGKVDGFYDVIAGALLCSGDESQRLIITWLKESDEGLNTFCSVISPEVCAVISRQSPEFRKLYWGALKQWASCLEYDVTESAWVTSEGAGSFDVLADRLRDLINSGESLKEETETALKALTLQDGDFSVKGVSVWTDLTLQLKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry