AibGenesis™ Mouse Anti-fitm1 Antibody (CBMOAB-76561FYA)


Cat: CBMOAB-76561FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76561FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO76561FYA 100 µg
MO-AB-12584R Monoclonal Cattle (Bos taurus) WB, ELISA MO12584R 100 µg
MO-AB-25852R Monoclonal Pig (Sus scrofa) WB, ELISA MO25852R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO76561FYA
SpecificityThis antibody binds to Zebrafish fitm1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fitm1 Antibody is a mouse antibody against fitm1. It can be used for fitm1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFat storage-inducing transmembrane protein 1; Fat-inducing protein 1; fitm1; fit
UniProt IDQ5CZN0
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MFLNSILVVITDLAAGLLGNTSFRRHFHLLLSALLLFGPLLSLWVSHYSVFAKRTHFLYRVFLRSGWGWTCIFVGSFVFVLSFSVRRSLTLSLRHLSRLAVAGGLWLGFRKLLCLLENATGSCYEPLSAALEMTSGTNGEGQPLLLLREAETKETCVRSGMLWRGYEVSEDALLLCLCCLLLAEETAVFGPYLNLGGPSEAPLRILFLFCVLLLSLWVFLLLCLLAYFPEFPTQLLGGALGCLSWRALYQGWYRLRPSWYCPGRPGVGLLSTQSKQDELLETQTNAKEID.
For Research Use Only | Not For Clinical Use.
Online Inquiry