Mouse Anti-gfer Antibody (CBMOAB-77786FYA)
Cat: CBMOAB-77786FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-77786FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO77786FYA | 100 µg | ||
| MO-AB-00523L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00523L | 100 µg | ||
| MO-AB-00588R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00588R | 100 µg | ||
| MO-AB-07804W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07804W | 100 µg | ||
| MO-AB-10880W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10880W | 100 µg | ||
| MO-AB-12977R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12977R | 100 µg | ||
| MO-AB-15402Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15402Y | 100 µg | ||
| MO-AB-25985H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25985C | 100 µg | ||
| MO-AB-26064R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26064R | 100 µg | ||
| MO-AB-30924W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30924W | 100 µg | ||
| MO-AB-33225H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33225C | 100 µg | ||
| MO-AB-34818W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34818W | 100 µg | ||
| MO-AB-41713W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41713W | 100 µg | ||
| MO-AB-55954W | Monoclonal | Marmoset | WB, ELISA | MO55954W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO77786FYA |
| Specificity | This antibody binds to Zebrafish gfer. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish gfer Antibody is a mouse antibody against gfer. It can be used for gfer detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Sulfhydryl oxidase; EC 1.8.3.2; gfe |
| UniProt ID | A4QNU9 |
| Protein Refseq | The length of the protein is 191 amino acids long. The sequence is show below: MAAAHGSSPHSSAGMEGFPFPVAGKPPEDSTSNDQTTTGETKKKPCRACTDFKSWMKLQKQASSASVQESRPVEELKPVECPLDREELGRSSWSFLHTMAAYYPDAPSTEQQLEMTQFINLFSKVFPCDECAEDLRTRLKTNRPDAGSRHKLSQWLCRLHNDINIRLGKPEFDCSRVDERWRDGWKDGSCD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry