Mouse Anti-gins1 Antibody (CBMOAB-77920FYA)


Cat: CBMOAB-77920FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-77920FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO77920FYA 100 µg
MO-AB-03897H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03897C 100 µg
MO-AB-13063R Monoclonal Cattle (Bos taurus) WB, ELISA MO13063R 100 µg
MO-AB-17081W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17081W 100 µg
MO-AB-26005H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26005C 100 µg
MO-AB-56007W Monoclonal Marmoset WB, ELISA MO56007W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO77920FYA
SpecificityThis antibody binds to Zebrafish gins1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish gins1 Antibody is a mouse antibody against gins1. It can be used for gins1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGINS complex subunit 1; Psf1 homolog; gins
UniProt IDQ5XJQ9
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MFCEKSVELIRELHRMGDGQLPAFNEDGIRQVLEEMKALYEQNQTDVNEAKTEGKSELIPSIKFRHSCLLRNQRCIAAYLYDRLLRIRALRWEYGSVLPTNIRFHMCAEEMEWFNQYKKSLATYMRSIGGEEGLDITQDMKPPKSLYIEVRCLKDHGEFEIDDGTVILLKKNSQHFLPRWKCEQLIRQGVLEHVIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry