Mouse Anti-gng7 Antibody (CBMOAB-78198FYA)
Cat: CBMOAB-78198FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-78198FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO78198FYA | 100 µg | ||
| MO-AB-00562L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00562L | 100 µg | ||
| MO-AB-03970H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03970C | 100 µg | ||
| MO-AB-06524Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06524Y | 100 µg | ||
| MO-AB-09041W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09041W | 100 µg | ||
| MO-AB-13182R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13182R | 100 µg | ||
| MO-AB-15563Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15563Y | 100 µg | ||
| MO-AB-26063H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26063C | 100 µg | ||
| MO-AB-56140W | Monoclonal | Marmoset | WB, ELISA | MO56140W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO78198FYA |
| Specificity | This antibody binds to Zebrafish gng7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish gng7 Antibody is a mouse antibody against gng7. It can be used for gng7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Guanine nucleotide-binding protein subunit gamma; gng |
| UniProt ID | Q6DGZ5 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MSTTNNIAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARSDPLLVGVPTSENPFKDKKPCIIL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry